PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf01363g00034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CPP
Protein Properties Length: 604aa    MW: 65455 Da    PI: 7.9175
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf01363g00034.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.82.5e-14124163242
                       TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                               ++k+CnCk+s+Clk+YCeCfa+g +C+  C+C++C+N+ e+
  Peaxi162Scf01363g00034.1 124 KQKQCNCKHSRCLKLYCECFASGMYCDG-CNCNNCHNNVEN 163
                               89**************************.********9875 PP

2TCR49.77.2e-16208247140
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                               k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC++CkN e
  Peaxi162Scf01363g00034.1 208 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCKECKNFE 247
                               589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.4E-16123163IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.648124248IPR005172CRC domain
PfamPF036383.9E-11125160IPR005172CRC domain
SMARTSM011144.8E-18208249IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.2E-12211246IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MEKSEGGDSF PPKKVQSEAA VAPPVDFPAK KLARQLDFTV FSGGGGQSPA TLPENSQQPV  60
PVKLTQLPRP QLQPQPQQHM VLLPIKQAVV GPTHPSIRPL SKPESPMARP RQNASEVKDG  120
TPKKQKQCNC KHSRCLKLYC ECFASGMYCD GCNCNNCHNN VENEPARREA VDATLERNPN  180
AFRPKIANSP HGARDNTEET GEGLLLAKHN KGCHCKKSGC LKKYCECFQA NILCSENCKC  240
KECKNFEGSE ERQALFHGDH ANNMAHLQQA ANAAITGAIG SSGYGSPPVI KKRKGQELFF  300
GSTMNEPVHR HGQFQQGNHI KASALPSLSS IPGQCVGNAA TVGPSKFTYR SLLADLIQPQ  360
DLKELCSVLV VYSGEAAKML ADEKDASLKQ AEGPREASLA STQERVQNQK DSGTEKDMAG  420
CCSSGDRGEK IGVEESSLDV ADVSKRRPMS PGTLALMCDE SDTMFTAGVT SPNDLATLSC  480
NTSSQLPHGQ GMTEIYAEQE RIVLTKFRDC LNRLITLGEI KETKCSSMVR GAGSASQNDM  540
ISNVITMTET RNQHEYFSNG VTRSPHPPQP RTVQLLSAVV STANNIPLPK VHHPDENGDV  600
KPKI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608929.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0V0IHB40.0A0A0V0IHB4_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000008240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-164Tesmin/TSO1-like CXC domain-containing protein